PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna23544.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 224aa    MW: 24793.6 Da    PI: 6.0437
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna23544.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.96.4e-101460347
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                             rWT  Ed+l+ +a   +  +   +W++Ia++++ g+t++++ +++ ++
  mrna23544.1-v1.0-hybrid 14 RWTRAEDKLFEQALVSFSEDlpdRWERIAEMVP-GKTAEEVLEHYETL 60
                             9*****************99*************.**********9875 PP

2Myb_DNA-binding43.57.3e-14119164247
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++WT+ E++l++ + kq+G+g+W++I+r +  +Rt+ q+ s+ qky
  mrna23544.1-v1.0-hybrid 119 KPWTEIEHKLFLVGLKQFGKGDWRSISRNVVVTRTPTQVASHAQKY 164
                              58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.7671065IPR017884SANT domain
SMARTSM007172.6E-91163IPR001005SANT/Myb domain
CDDcd001671.66E-81461No hitNo description
Gene3DG3DSA:1.10.10.604.4E-61461IPR009057Homeodomain-like
PfamPF002493.5E-81460IPR001005SANT/Myb domain
SuperFamilySSF466893.38E-121469IPR009057Homeodomain-like
PROSITE profilePS5129417.12113169IPR017930Myb domain
SuperFamilySSF466891.17E-15115169IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-16116168IPR006447Myb domain, plants
SMARTSM007175.4E-11117167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-9117163IPR009057Homeodomain-like
PfamPF002492.4E-11119164IPR001005SANT/Myb domain
CDDcd001671.12E-8120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MFQEAPPCWS SSARWTRAED KLFEQALVSF SEDLPDRWER IAEMVPGKTA EEVLEHYETL  60
VHDVVEIDSG RVELPSYADD SAAAGVGWDS ASQISFDGCK ANNTNNNAAS EAAERKKGKP  120
WTEIEHKLFL VGLKQFGKGD WRSISRNVVV TRTPTQVASH AQKYFLRQSS GKKERKRSSI  180
HDITSVDTNS VPAPAERKWI PSPPPPPGDQ GGSFGFQDFG FPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1515771173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011469263.11e-166PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-64DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM5WIS81e-112M5WIS8_PRUPE; Uncharacterized protein
STRINGGLYMA10G42450.12e-92(Glycine max)
STRINGGLYMA20G24600.12e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-73MYB family protein